PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01004942001
Common NameLOC100250592, VIT_01s0244g00150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ARF
Protein Properties Length: 768aa    MW: 86054.6 Da    PI: 6.8932
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01004942001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.18.1e-24116217199
                        EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                        f+k+lt sd++++g +++ +++a+e+      + k++ +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   +
  GSVIVT01004942001 116 FCKTLTASDTSTHGGFSVLRRHADEClppldmS-KQPPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSLFVSSKKLVAGDAFIFL--R 204
                        99*****************************63.4445569************************************************..4 PP

                        SSEE..EEEEE-S CS
                 B3  87 rsefelvvkvfrk 99 
                         +++el+v+v+r+
  GSVIVT01004942001 205 GENGELRVGVRRA 217
                        49999*****996 PP

2Auxin_resp1201.8e-39242324183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        a+ha+st+++F+v+Y+Pr+s++eF+++++++++a+k+++s+GmRfkm+fe+e+++e+r++Gtv+g++d+dp+rWp+SkWr+Lk
  GSVIVT01004942001 242 AWHAVSTGTIFTVYYKPRTSPAEFIIPFDQYMEAVKNHYSIGMRFKMKFEGEEAPEQRFTGTVIGTEDADPMRWPGSKWRCLK 324
                        89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.66E-40105245IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-40109231IPR015300DNA-binding pseudobarrel domain
CDDcd100171.84E-21114216No hitNo description
PROSITE profilePS5086311.984116218IPR003340B3 DNA binding domain
PfamPF023627.9E-22116217IPR003340B3 DNA binding domain
SMARTSM010191.8E-23116218IPR003340B3 DNA binding domain
PfamPF065071.6E-36242324IPR010525Auxin response factor
PfamPF023092.0E-10627728IPR033389AUX/IAA domain
SuperFamilySSF542773.73E-11636715No hitNo description
PROSITE profilePS5174524.764638731IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MDFVDSEDAL YKELWHACAG PLVTVPRVGE RVFYFPQGHL EQVEASTNQV ADQQMPAYDL  60
RAKILCRVIN VHLKAESDTD EVFAQVTLLP EPKQDENSAE KEDVLTPTPR PRVHSFCKTL  120
TASDTSTHGG FSVLRRHADE CLPPLDMSKQ PPTQELVAKD LHGNEWRFRH IFRGQPRRHL  180
LQSGWSLFVS SKKLVAGDAF IFLRGENGEL RVGVRRAMRQ LSNGPSSVIS SHSMHLGVLA  240
TAWHAVSTGT IFTVYYKPRT SPAEFIIPFD QYMEAVKNHY SIGMRFKMKF EGEEAPEQRF  300
TGTVIGTEDA DPMRWPGSKW RCLKVRWDET SSVPRPECVS PWNIEVALTP PSLNPLPVSR  360
SKRPRANMMS SSTESSVLTR EGLSKVTIDH SPGSGFSRAL QGQEISTLRG IFMENNNDLV  420
TTQKSIVQPR SQVVDQMDSA STKRSFMSED WVPQLRQGVQ CANLISGPQS MMHSSTVLNM  480
ESNVKLSEGA KGKPYPTPAN VRYSGFSGYG GLHDLGAEQC PGNWLLPLLP HSYSETTPHL  540
MGLKPQPLYV QEEVVKSKGD GNCKLFGISL ISKPAANPMH RPQGEIQLTM ENPARHPEQS  600
KSSKYMEIGG FEHEKPFQAL EQQLSRDDQS KLHSGSTRSC IKVHKQGIAV GRSVDLTKFN  660
GYTELISELD QIFEFNGELI SLNKDWLIVF TDDEGDMMLV GDDPWPEFCS MVRKIFVYTR  720
EEIQRMDPRP LNPKSWRHPS AVSLWGRASL PELTMEHLFV TSGCEGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-171834517353Auxin response factor 1
4ldw_A1e-171834517353Auxin response factor 1
4ldw_B1e-171834517353Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.171390.0cell culture| flower| fruit
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3802690.0FQ380269.1 Vitis vinifera clone SS0ACG7YK15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002268849.10.0PREDICTED: auxin response factor 2-like
RefseqXP_010656858.10.0PREDICTED: auxin response factor 2-like
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLF6HWQ30.0F6HWQ3_VITVI; Auxin response factor
STRINGVIT_01s0244g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2